Lineage for d1gtib1 (1gti B:79-209)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein Class pi GST [81347] (4 species) 
Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries) 
Domain d1gtib1: 1gti B:79-209 [17599]
Other proteins in same PDB: d1gtia2, d1gtib2, d1gtic2, d1gtid2, d1gtie2, d1gtif2
complexed with gtb
Details for d1gtib1
PDB Entry: 1gti (more details), 3 Å
PDB Description: modified glutathione s-transferase (pi) complexed with s (p- nitrobenzyl)glutathione
PDB Compounds: (B:) glutathione s-transferaseSCOPe Domain Sequences for d1gtib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtib1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq
SCOPe Domain Coordinates for d1gtib1:
Click to download the PDB-style file with coordinates for d1gtib1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gtib1:
View in 3D
