Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (19 species) not a true protein |
Species Staphylococcus aureus [TaxId:273036] [188831] (12 PDB entries) |
Domain d3fqoa_: 3fqo A: [175983] automated match to d1ddra_ complexed with n22, ndp; mutant |
PDB Entry: 3fqo (more details), 2.09 Å
SCOPe Domain Sequences for d3fqoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fqoa_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 273036]} tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd tffppytfedwevassvegkldekntiphtflhlirk
Timeline for d3fqoa_: