Lineage for d3fqcb_ (3fqc B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004246Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1004247Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1004553Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1004554Protein automated matches [190777] (8 species)
    not a true protein
  7. 1004634Species Staphylococcus aureus [TaxId:273036] [188831] (12 PDB entries)
  8. 1004645Domain d3fqcb_: 3fqc B: [175974]
    automated match to d1dhja_
    complexed with 55v, nap

Details for d3fqcb_

PDB Entry: 3fqc (more details), 2.35 Å

PDB Description: staphylococcus aureus dihydrofolate reductase complexed with nadph and 2,4-diamino-5-[3-(3,4,5-trimethoxyphenyl)pent-1-ynyl]-6- methylpyrimidine (ucp115a)
PDB Compounds: (B:) Trimethoprim-sensitive dihydrofolate reductase

SCOPe Domain Sequences for d3fqcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fqcb_ c.71.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 273036]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d3fqcb_:

Click to download the PDB-style file with coordinates for d3fqcb_.
(The format of our PDB-style files is described here.)

Timeline for d3fqcb_: