SCOPe 2.08: Domain d3fqca_: 3fqc A:

Lineage for d3fqca_ (3fqc A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:273036] [188831] (12 PDB entries)

8. Domain d3fqca_: 3fqc A: [175973]
   automated match to d1dhja_
   complexed with 55v, ndp

Details for d3fqca_

PDB Entry: 3fqc, 2.35 Å

PDB Description: staphylococcus aureus dihydrofolate reductase complexed with nadph and 2,4-diamino-5-[3-(3,4,5-trimethoxyphenyl)pent-1-ynyl]-6- methylpyrimidine (ucp115a)

PDB Compounds: (A:) Trimethoprim-sensitive dihydrofolate reductase

SCOPe Domain Sequences for d3fqca_:

Sequence; same for both SEQRES and ATOM records:

>d3fqca_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 273036]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

Timeline for d3fqca_:

• d3fqca_ first appeared in SCOPe 2.01
  
• d3fqca_ appears in SCOPe 2.07