Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.27: CalX-like [141072] (2 families) |
Family b.1.27.0: automated matches [191575] (1 protein) not a true family |
Protein automated matches [191010] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188932] (3 PDB entries) |
Domain d3fq4b1: 3fq4 B:989-1107 [175966] Other proteins in same PDB: d3fq4a2, d3fq4b2 automated match to d2fwsa1 |
PDB Entry: 3fq4 (more details), 1.49 Å
SCOPe Domain Sequences for d3fq4b1:
Sequence, based on SEQRES records: (download)
>d3fq4b1 b.1.27.0 (B:989-1107) automated matches {Human (Homo sapiens) [TaxId: 9606]} rdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegellf qpgeawkelqvkllelqevdsllrgrqvrrfhvqlsnpkfgahlgqphsttiiirdpde
>d3fq4b1 b.1.27.0 (B:989-1107) automated matches {Human (Homo sapiens) [TaxId: 9606]} rdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegellf qpgeawkelqvkllelsllrgrqvrrfhvqlsnpkfgahlgqphsttiiirdpde
Timeline for d3fq4b1: