Lineage for d3fq4b1 (3fq4 B:989-1107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766760Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 2766776Family b.1.27.0: automated matches [191575] (1 protein)
    not a true family
  6. 2766777Protein automated matches [191010] (2 species)
    not a true protein
  7. 2766788Species Human (Homo sapiens) [TaxId:9606] [188932] (3 PDB entries)
  8. 2766792Domain d3fq4b1: 3fq4 B:989-1107 [175966]
    Other proteins in same PDB: d3fq4a2, d3fq4b2
    automated match to d2fwsa1

Details for d3fq4b1

PDB Entry: 3fq4 (more details), 1.49 Å

PDB Description: Crystal structure of the Calx-beta domain of integrin beta4
PDB Compounds: (B:) Integrin beta-4

SCOPe Domain Sequences for d3fq4b1:

Sequence, based on SEQRES records: (download)

>d3fq4b1 b.1.27.0 (B:989-1107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegellf
qpgeawkelqvkllelqevdsllrgrqvrrfhvqlsnpkfgahlgqphsttiiirdpde

Sequence, based on observed residues (ATOM records): (download)

>d3fq4b1 b.1.27.0 (B:989-1107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegellf
qpgeawkelqvkllelsllrgrqvrrfhvqlsnpkfgahlgqphsttiiirdpde

SCOPe Domain Coordinates for d3fq4b1:

Click to download the PDB-style file with coordinates for d3fq4b1.
(The format of our PDB-style files is described here.)

Timeline for d3fq4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fq4b2