SCOPe 2.05: Domain d3fq0a_: 3fq0 A:

Lineage for d3fq0a_ (3fq0 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:273036] [188831] (12 PDB entries)

8. Domain d3fq0a_: 3fq0 A: [175962]
   automated match to d1dhja_
   complexed with n22, ndp

Details for d3fq0a_

PDB Entry: 3fq0, 1.69 Å

PDB Description: staphylococcus aureus dihydrofolate reductase complexed with nadph and 2,4-diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120b)

PDB Compounds: (A:) Trimethoprim-sensitive dihydrofolate reductase

SCOPe Domain Sequences for d3fq0a_:

Sequence; same for both SEQRES and ATOM records:

>d3fq0a_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 273036]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

Timeline for d3fq0a_:

• d3fq0a_ first appeared in SCOPe 2.01
  
• d3fq0a_ appears in SCOPe 2.04
  
• d3fq0a_ appears in SCOPe 2.06
  
• d3fq0a_ appears in the current release, SCOPe 2.08