Lineage for d3fpza_ (3fpz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2850254Family c.3.1.6: Thi4-like [141942] (2 proteins)
    Pfam PF01946; stand-alone, moderately decorated domain
  6. 2850255Protein Thiazole biosynthetic enzyme Thi4 [141943] (2 species)
  7. 2850256Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141944] (2 PDB entries)
    Uniprot P32318 16-326
    mitochondrial
  8. 2850257Domain d3fpza_: 3fpz A: [175960]
    complexed with ahz, so4

Details for d3fpza_

PDB Entry: 3fpz (more details), 1.82 Å

PDB Description: saccharomyces cerevisiae thi4p is a suicide thiamin thiazole synthase
PDB Compounds: (A:) Thiazole biosynthetic enzyme

SCOPe Domain Sequences for d3fpza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fpza_ c.3.1.6 (A:) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hlnstpvthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgags
sglsaayviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipyed
egdyvvvkhaalfistvlskvlqlpnvklfnatcvedlvtrpptekgevtvagvvtnwtl
vtqahgtqcamdpnvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidqn
qklggmkgldmnhaehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvh
aaeqilkhfaa

SCOPe Domain Coordinates for d3fpza_:

Click to download the PDB-style file with coordinates for d3fpza_.
(The format of our PDB-style files is described here.)

Timeline for d3fpza_: