Lineage for d1gsya1 (1gsy A:79-209)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 642036Protein Class pi GST [81347] (4 species)
  7. 642127Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries)
  8. 642140Domain d1gsya1: 1gsy A:79-209 [17596]
    Other proteins in same PDB: d1gsya2, d1gsyb2

Details for d1gsya1

PDB Entry: 1gsy (more details), 2.4 Å

PDB Description: glutathione s-transferase yfyf, class pi, complexed with glutathione
PDB Compounds: (A:) glutathione s-transferase class pi

SCOP Domain Sequences for d1gsya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsya1 a.45.1.1 (A:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOP Domain Coordinates for d1gsya1:

Click to download the PDB-style file with coordinates for d1gsya1.
(The format of our PDB-style files is described here.)

Timeline for d1gsya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsya2