SCOPe 2.05: Domain d3fpya_: 3fpy A:

Lineage for d3fpya_ (3fpy A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (87 PDB entries)
   Uniprot P00282

8. Domain d3fpya_: 3fpy A: [175959]
   automated match to d1ag0a_
   complexed with cu, trs

Details for d3fpya_

PDB Entry: 3fpy, 2.1 Å

PDB Description: azurin c112d/m121l

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d3fpya_:

Sequence; same for both SEQRES and ATOM records:

>d3fpya_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsal
lkgtltlk

Timeline for d3fpya_:

• d3fpya_ first appeared in SCOPe 2.01
  
• d3fpya_ appears in SCOPe 2.04
  
• d3fpya_ appears in SCOPe 2.06
  
• d3fpya_ appears in the current release, SCOPe 2.08