SCOPe 2.08: Domain d3fpia1: 3fpi A:1-159

Lineage for d3fpia1 (3fpi A:1-159)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein automated matches [190985] (6 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [188680] (2 PDB entries)

8. Domain d3fpia1: 3fpi A:1-159 [175955]
   Other proteins in same PDB: d3fpia2
   automated match to d1gx1a_
   complexed with cl, ctp, epe, mg, so4

Details for d3fpia1

PDB Entry: 3fpi, 2.8 Å

PDB Description: Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase IspF complexed with Cytidine Triphosphate

PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3fpia1:

Sequence; same for both SEQRES and ATOM records:

>d3fpia1 d.79.5.1 (A:1-159) automated matches {Yersinia pestis [TaxId: 214092]}
mrighgfdvhkfgengsgpliiggvripyekgllahsdgdvalhaatdallgaaalgdig
klfpdtdpafkgadsrgllreayrrilakgyklgnlditiiaqapkmaphipqmrvnlae
dlqchmddinvkattteqlgftgrgegiaceavvllvnv

Timeline for d3fpia1:

• d3fpia1 first appeared in SCOPe 2.01, called d3fpia_
  
• d3fpia1 appears in SCOPe 2.07