SCOPe 2.07: Domain d3fp8e_: 3fp8 E:

Lineage for d3fp8e_ (3fp8 E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)

8. Domain d3fp8e_: 3fp8 E: [175953]
   Other proteins in same PDB: d3fp8i_
   automated match to d1anea_
   complexed with ca, edo, pg4, so4

Details for d3fp8e_

PDB Entry: 3fp8, 1.46 Å

PDB Description: anionic trypsin variant s195a in complex with bovine pancreatic trypsin inhibitor (bpti) determined to the 1.46 a resolution limit

PDB Compounds: (E:) Anionic trypsin-2

SCOPe Domain Sequences for d3fp8e_:

Sequence; same for both SEQRES and ATOM records:

>d3fp8e_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d3fp8e_:

• d3fp8e_ first appeared in SCOPe 2.01
  
• d3fp8e_ appears in SCOPe 2.06
  
• d3fp8e_ appears in the current release, SCOPe 2.08