Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries) |
Domain d3fp8e_: 3fp8 E: [175953] Other proteins in same PDB: d3fp8i_ automated match to d1anea_ complexed with ca, edo, pg4, so4 |
PDB Entry: 3fp8 (more details), 1.46 Å
SCOPe Domain Sequences for d3fp8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fp8e_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]} ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
Timeline for d3fp8e_: