Lineage for d3fp6e_ (3fp6 E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953999Protein Trypsin(ogen) [50515] (9 species)
  7. 954411Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (36 PDB entries)
  8. 954414Domain d3fp6e_: 3fp6 E: [175950]
    Other proteins in same PDB: d3fp6i_
    automated match to d1amha_
    complexed with ca, edo, pg4, so4

Details for d3fp6e_

PDB Entry: 3fp6 (more details), 1.49 Å

PDB Description: anionic trypsin in complex with bovine pancreatic trypsin inhibitor (bpti) determined to the 1.49 a resolution limit
PDB Compounds: (E:) Anionic trypsin-2

SCOPe Domain Sequences for d3fp6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fp6e_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d3fp6e_:

Click to download the PDB-style file with coordinates for d3fp6e_.
(The format of our PDB-style files is described here.)

Timeline for d3fp6e_: