![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class pi GST [81347] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries) |
![]() | Domain d2glrb1: 2glr B:79-209 [17595] Other proteins in same PDB: d2glra2, d2glrb2 complexed with gtx |
PDB Entry: 2glr (more details), 2.2 Å
SCOPe Domain Sequences for d2glrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glrb1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]} ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh vnrpingngkq
Timeline for d2glrb1: