Lineage for d2glrb1 (2glr B:79-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713204Protein Class pi GST [81347] (4 species)
  7. 2713354Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries)
  8. 2713366Domain d2glrb1: 2glr B:79-209 [17595]
    Other proteins in same PDB: d2glra2, d2glrb2
    complexed with gtx

Details for d2glrb1

PDB Entry: 2glr (more details), 2.2 Å

PDB Description: molecular structure at 1.8 angstroms of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors
PDB Compounds: (B:) glutathione s-transferase yfyf

SCOPe Domain Sequences for d2glrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glrb1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOPe Domain Coordinates for d2glrb1:

Click to download the PDB-style file with coordinates for d2glrb1.
(The format of our PDB-style files is described here.)

Timeline for d2glrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2glrb2