SCOPe 2.05: Domain d3fp5a_: 3fp5 A:

Lineage for d3fp5a_ (3fp5 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families)

5. Family a.11.1.0: automated matches [191596] (1 protein)
   not a true family

6. Protein automated matches [191086] (4 species)
   not a true protein

7. Species Moniliophthora perniciosa [TaxId:153609] [189115] (1 PDB entry)

8. Domain d3fp5a_: 3fp5 A: [175949]
   automated match to d1acaa_
   complexed with mes, zn

Details for d3fp5a_

PDB Entry: 3fp5, 1.61 Å

PDB Description: Crystal structure of ACBP from Moniliophthora perniciosa

PDB Compounds: (A:) acyl-coa binding protein

SCOPe Domain Sequences for d3fp5a_:

Sequence; same for both SEQRES and ATOM records:

>d3fp5a_ a.11.1.0 (A:) automated matches {Moniliophthora perniciosa [TaxId: 153609]}
shmskakfdkaveivqslpkdgpikptqdeqlyfykyfkqatvgdvnisrpglmdftgka
kwdawksvegtskevayqkyveklleilkkadteeskkyiaeieaa

Timeline for d3fp5a_:

• d3fp5a_ first appeared in SCOPe 2.01
  
• d3fp5a_ appears in SCOPe 2.04
  
• d3fp5a_ appears in SCOPe 2.06
  
• d3fp5a_ appears in the current release, SCOPe 2.08