Class a: All alpha proteins [46456] (284 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) |
Family a.11.1.0: automated matches [191596] (1 protein) not a true family |
Protein automated matches [191086] (2 species) not a true protein |
Species Moniliophthora perniciosa [TaxId:153609] [189115] (1 PDB entry) |
Domain d3fp5a_: 3fp5 A: [175949] automated match to d1acaa_ complexed with mes, zn |
PDB Entry: 3fp5 (more details), 1.61 Å
SCOPe Domain Sequences for d3fp5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fp5a_ a.11.1.0 (A:) automated matches {Moniliophthora perniciosa [TaxId: 153609]} shmskakfdkaveivqslpkdgpikptqdeqlyfykyfkqatvgdvnisrpglmdftgka kwdawksvegtskevayqkyveklleilkkadteeskkyiaeieaa
Timeline for d3fp5a_: