Lineage for d3fp5a_ (3fp5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697427Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 2697448Family a.11.1.0: automated matches [191596] (1 protein)
    not a true family
  6. 2697449Protein automated matches [191086] (6 species)
    not a true protein
  7. 2697465Species Moniliophthora perniciosa [TaxId:153609] [189115] (1 PDB entry)
  8. 2697466Domain d3fp5a_: 3fp5 A: [175949]
    automated match to d1acaa_
    complexed with mes, zn

Details for d3fp5a_

PDB Entry: 3fp5 (more details), 1.61 Å

PDB Description: Crystal structure of ACBP from Moniliophthora perniciosa
PDB Compounds: (A:) acyl-coa binding protein

SCOPe Domain Sequences for d3fp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fp5a_ a.11.1.0 (A:) automated matches {Moniliophthora perniciosa [TaxId: 153609]}
shmskakfdkaveivqslpkdgpikptqdeqlyfykyfkqatvgdvnisrpglmdftgka
kwdawksvegtskevayqkyveklleilkkadteeskkyiaeieaa

SCOPe Domain Coordinates for d3fp5a_:

Click to download the PDB-style file with coordinates for d3fp5a_.
(The format of our PDB-style files is described here.)

Timeline for d3fp5a_: