SCOPe 2.06: Domain d3fond1: 3fon D:1-99

Lineage for d3fond1 (3fon D:1-99)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
   Uniprot P01887

8. Domain d3fond1: 3fon D:1-99 [175934]
   Other proteins in same PDB: d3fonb2, d3fond2
   automated match to d1bz9b_

Details for d3fond1

PDB Entry: 3fon, 2.03 Å

PDB Description: crystal structure of the class i mhc molecule h-2kwm7 with a single self peptide vndifeai

PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d3fond1:

Sequence; same for both SEQRES and ATOM records:

>d3fond1 b.1.1.2 (D:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d3fond1:

• d3fond1 first appeared in SCOPe 2.01, called d3fond_
  
• d3fond1 was called d3fond_ in SCOPe 2.05
  
• d3fond1 appears in SCOPe 2.07
  
• d3fond1 appears in the current release, SCOPe 2.08