Lineage for d3fonb1 (3fon B:1-99)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746555Domain d3fonb1: 3fon B:1-99 [175933]
    Other proteins in same PDB: d3fonb2, d3fond2
    automated match to d1bz9b_

Details for d3fonb1

PDB Entry: 3fon (more details), 2.03 Å

PDB Description: crystal structure of the class i mhc molecule h-2kwm7 with a single self peptide vndifeai
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3fonb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fonb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d3fonb1:

Click to download the PDB-style file with coordinates for d3fonb1.
(The format of our PDB-style files is described here.)

Timeline for d3fonb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fonb2