![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:198094] [188737] (1 PDB entry) |
![]() | Domain d3fobb1: 3fob B:1-278 [175929] Other proteins in same PDB: d3fobb2 automated match to d1broa_ complexed with cl, na |
PDB Entry: 3fob (more details), 1.74 Å
SCOPe Domain Sequences for d3fobb1:
Sequence, based on SEQRES records: (download)
>d3fobb1 c.69.1.0 (B:1-278) automated matches {Bacillus anthracis [TaxId: 198094]} makitvgtenqapieiyyedhgtgkpvvlihgwplsgrsweyqvpalveagyrvitydrr gfgkssqpwegyeydtftsdlhqlleqlelqnvtlvgfsmgggevaryistygtdriekv vfagavppylyksedhpegalddatietfksgvindrlafldeftkgffaagdrtdlvse sfrlynwdiaagaspkgtldcitafsktdfrkdlekfniptliihgdsdatvpfeysgkl theaipnskvalikggphglnathakefnealllflkd
>d3fobb1 c.69.1.0 (B:1-278) automated matches {Bacillus anthracis [TaxId: 198094]} makinqapieiyyedhgtgkpvvlihgwplsgrsweyqvpalveagyrvitydrrgfgks sqpwegyeydtftsdlhqlleqlelqnvtlvgfsmgggevaryistygtdriekvvfaga vppylyksedhpegalddatietfksgvindrlafldeftkgffaagdrtdlvsesfrly nwdiaagaspkgtldcitafsktdfrkdlekfniptliihgdsdatvpfeysgkltheai pnskvalikggphglnathakefnealllflkd
Timeline for d3fobb1: