| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (124 species) not a true protein |
| Species Bacillus anthracis [TaxId:198094] [188737] (1 PDB entry) |
| Domain d3foba_: 3fob A: [175928] Other proteins in same PDB: d3fobb2 automated match to d1broa_ complexed with cl, na |
PDB Entry: 3fob (more details), 1.74 Å
SCOPe Domain Sequences for d3foba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3foba_ c.69.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
akitvgtenqapieiyyedhgtgkpvvlihgwplsgrsweyqvpalveagyrvitydrrg
fgkssqpwegyeydtftsdlhqlleqlelqnvtlvgfsmgggevaryistygtdriekvv
fagavppylyksedhpegalddatietfksgvindrlafldeftkgffaagdrtdlvses
frlynwdiaagaspkgtldcitafsktdfrkdlekfniptliihgdsdatvpfeysgklt
heaipnskvalikggphglnathakefnealllflkd
Timeline for d3foba_: