Lineage for d3foba_ (3fob A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509465Species Bacillus anthracis [TaxId:198094] [188737] (1 PDB entry)
  8. 2509466Domain d3foba_: 3fob A: [175928]
    Other proteins in same PDB: d3fobb2
    automated match to d1broa_
    complexed with cl, na

Details for d3foba_

PDB Entry: 3fob (more details), 1.74 Å

PDB Description: crystal structure of bromoperoxidase from bacillus anthracis
PDB Compounds: (A:) Bromoperoxidase

SCOPe Domain Sequences for d3foba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3foba_ c.69.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
akitvgtenqapieiyyedhgtgkpvvlihgwplsgrsweyqvpalveagyrvitydrrg
fgkssqpwegyeydtftsdlhqlleqlelqnvtlvgfsmgggevaryistygtdriekvv
fagavppylyksedhpegalddatietfksgvindrlafldeftkgffaagdrtdlvses
frlynwdiaagaspkgtldcitafsktdfrkdlekfniptliihgdsdatvpfeysgklt
heaipnskvalikggphglnathakefnealllflkd

SCOPe Domain Coordinates for d3foba_:

Click to download the PDB-style file with coordinates for d3foba_.
(The format of our PDB-style files is described here.)

Timeline for d3foba_: