Lineage for d3fo7a_ (3fo7 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925358Protein Snake phospholipase A2 [48624] (35 species)
  7. 925543Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (28 PDB entries)
    Uniprot P59071
  8. 925554Domain d3fo7a_: 3fo7 A: [175927]
    automatically matched to d1cl5a_
    complexed with imn, so4

Details for d3fo7a_

PDB Entry: 3fo7 (more details), 1.4 Å

PDB Description: Simultaneous inhibition of anti-coagulation and inflammation: Crystal structure of phospholipase A2 complexed with indomethacin at 1.4 A resolution reveals the presence of the new common ligand binding site
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d3fo7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fo7a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d3fo7a_:

Click to download the PDB-style file with coordinates for d3fo7a_.
(The format of our PDB-style files is described here.)

Timeline for d3fo7a_: