SCOPe 2.03: Domain d3fnkc_: 3fnk C:

Lineage for d3fnkc_ (3fnk C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Cellulosomal scaffoldin adaptor protein B, ScaB [110073] (1 species)

7. Species Acetivibrio cellulolyticus [TaxId:35830] [110074] (4 PDB entries)
   Uniprot Q7WYN3 29-199

8. Domain d3fnkc_: 3fnk C: [175923]
   automated match to d1qzna_
   complexed with act, bu1, edo, pdo

Details for d3fnkc_

PDB Entry: 3fnk, 1.99 Å

PDB Description: crystal structure of the second type ii cohesin module from the cellulosomal adaptor scaa scaffoldin of acetivibrio cellulolyticus

PDB Compounds: (C:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d3fnkc_:

Sequence; same for both SEQRES and ATOM records:

>d3fnkc_ b.2.2.2 (C:) Cellulosomal scaffoldin adaptor protein B, ScaB {Acetivibrio cellulolyticus [TaxId: 35830]}
dmikasyitmgydknaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvay
tnsslptsgellvsedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvg
fkvlqkkattvvfedsetmpngitgttlfnwygnriqsgyfviqpgeinsap

Timeline for d3fnkc_:

• d3fnkc_ first appeared in SCOPe 2.01
  
• d3fnkc_ appears in SCOPe 2.02
  
• d3fnkc_ appears in SCOPe 2.04
  
• d3fnkc_ appears in the current release, SCOPe 2.08