SCOPe 2.02: Domain d3fnkb_: 3fnk B:

Lineage for d3fnkb_ (3fnk B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Cellulosomal scaffoldin adaptor protein B, ScaB [110073] (1 species)

7. Species Acetivibrio cellulolyticus [TaxId:35830] [110074] (4 PDB entries)
   Uniprot Q7WYN3 29-199

8. Domain d3fnkb_: 3fnk B: [175922]
   automated match to d1qzna_
   complexed with act, bu1, edo, pdo

Details for d3fnkb_

PDB Entry: 3fnk, 1.99 Å

PDB Description: crystal structure of the second type ii cohesin module from the cellulosomal adaptor scaa scaffoldin of acetivibrio cellulolyticus

PDB Compounds: (B:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d3fnkb_:

Sequence; same for both SEQRES and ATOM records:

>d3fnkb_ b.2.2.2 (B:) Cellulosomal scaffoldin adaptor protein B, ScaB {Acetivibrio cellulolyticus [TaxId: 35830]}
mikasyitmgydknaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvayt
nsslptsgellvsedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgf
kvlqkkattvvfedsetmpngitgttlfnwygnriqsgyfviqpgeinsap

Timeline for d3fnkb_:

• d3fnkb_ first appeared in SCOPe 2.01
  
• d3fnkb_ appears in SCOPe 2.03
  
• d3fnkb_ appears in the current release, SCOPe 2.08