Lineage for d3fnka_ (3fnk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767240Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2767241Protein Cellulosomal scaffoldin adaptor protein B, ScaB [110073] (1 species)
  7. 2767242Species Acetivibrio cellulolyticus [TaxId:35830] [110074] (8 PDB entries)
    Uniprot Q7WYN3 29-199
  8. 2767256Domain d3fnka_: 3fnk A: [175921]
    automated match to d1qzna_
    complexed with act, bu1, edo, pdo

Details for d3fnka_

PDB Entry: 3fnk (more details), 1.99 Å

PDB Description: crystal structure of the second type ii cohesin module from the cellulosomal adaptor scaa scaffoldin of acetivibrio cellulolyticus
PDB Compounds: (A:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d3fnka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fnka_ b.2.2.2 (A:) Cellulosomal scaffoldin adaptor protein B, ScaB {Acetivibrio cellulolyticus [TaxId: 35830]}
nldmikasyitmgydknaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgv
aytnsslptsgellvsedygpivqgvhkisegilnlsrsytalevyrasespeetgtlav
vgfkvlqkkattvvfedsetmpngitgttlfnwygnriqsgyfviqpgeinsap

SCOPe Domain Coordinates for d3fnka_:

Click to download the PDB-style file with coordinates for d3fnka_.
(The format of our PDB-style files is described here.)

Timeline for d3fnka_: