Lineage for d3fncb1 (3fnc B:1-160)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575816Species Listeria innocua [TaxId:272626] [188770] (1 PDB entry)
  8. 2575818Domain d3fncb1: 3fnc B:1-160 [175910]
    Other proteins in same PDB: d3fncb2
    automated match to d1wk4a_
    complexed with edo, mli

Details for d3fncb1

PDB Entry: 3fnc (more details), 1.75 Å

PDB Description: crystal structure of a putative acetyltransferase from listeria innocua
PDB Compounds: (B:) putative acetyltransferase

SCOPe Domain Sequences for d3fncb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fncb1 d.108.1.0 (B:1-160) automated matches {Listeria innocua [TaxId: 272626]}
mdfhirkatnsdaeaiqhvattswhhtyqdlipsdvqddflkrfynvetlhnrisatpfa
vleqadkvigfanfielekgkselaafyllpevtqrglgtellevgmtlfhvplpmfvnv
ekgnetaihfykakgfvqveeftedfygypletirfnlnh

SCOPe Domain Coordinates for d3fncb1:

Click to download the PDB-style file with coordinates for d3fncb1.
(The format of our PDB-style files is described here.)

Timeline for d3fncb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fncb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3fnca_