Lineage for d3fnca_ (3fnc A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209902Species Listeria innocua [TaxId:272626] [188770] (1 PDB entry)
  8. 2209903Domain d3fnca_: 3fnc A: [175909]
    Other proteins in same PDB: d3fncb2
    automated match to d1wk4a_
    complexed with edo, mli

Details for d3fnca_

PDB Entry: 3fnc (more details), 1.75 Å

PDB Description: crystal structure of a putative acetyltransferase from listeria innocua
PDB Compounds: (A:) putative acetyltransferase

SCOPe Domain Sequences for d3fnca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fnca_ d.108.1.0 (A:) automated matches {Listeria innocua [TaxId: 272626]}
mdfhirkatnsdaeaiqhvattswhhtyqdlipsdvqddflkrfynvetlhnrisatpfa
vleqadkvigfanfielekgkselaafyllpevtqrglgtellevgmtlfhvplpmfvnv
ekgnetaihfykakgfvqveeftedfygypletirfnlnh

SCOPe Domain Coordinates for d3fnca_:

Click to download the PDB-style file with coordinates for d3fnca_.
(The format of our PDB-style files is described here.)

Timeline for d3fnca_: