Lineage for d3flud1 (3flu D:1-291)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098737Species Neisseria meningitidis [TaxId:491] [188931] (1 PDB entry)
  8. 2098741Domain d3flud1: 3flu D:1-291 [175898]
    Other proteins in same PDB: d3flua2, d3fluc2, d3flud2
    automated match to d1dhpa_
    complexed with gol, so4

Details for d3flud1

PDB Entry: 3flu (more details), 2 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis
PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3flud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3flud1 c.1.10.0 (D:1-291) automated matches {Neisseria meningitidis [TaxId: 491]}
mlqgslvalitpmnqdgsihyeqlrdlidwhiengtdgivavgttgesatlsveehtavi
eavvkhvakrvpviagtganntveaialsqaaekagadytlsvvpyynkpsqegiyqhfk
tiaeatsipmiiynvpgrtvvsmtndtilrlaeipnivgvkeasgnigsnielinrapeg
fvvlsgddhtalpfmlcgghgvitvaanaapklfadmcraalqgdialarelndrlipiy
dtmfcepspaapkwavsalgrcephvrlplvpltengqakvraalkasgql

SCOPe Domain Coordinates for d3flud1:

Click to download the PDB-style file with coordinates for d3flud1.
(The format of our PDB-style files is described here.)

Timeline for d3flud1: