Lineage for d3fluc_ (3flu C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 973199Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 973200Protein automated matches [190115] (26 species)
    not a true protein
  7. 973354Species Neisseria meningitidis [TaxId:491] [188931] (1 PDB entry)
  8. 973357Domain d3fluc_: 3flu C: [175897]
    automated match to d1dhpa_
    complexed with gol, so4

Details for d3fluc_

PDB Entry: 3flu (more details), 2 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis
PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3fluc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fluc_ c.1.10.0 (C:) automated matches {Neisseria meningitidis [TaxId: 491]}
tmlqgslvalitpmnqdgsihyeqlrdlidwhiengtdgivavgttgesatlsveehtav
ieavvkhvakrvpviagtganntveaialsqaaekagadytlsvvpyynkpsqegiyqhf
ktiaeatsipmiiynvpgrtvvsmtndtilrlaeipnivgvkeasgnigsnielinrape
gfvvlsgddhtalpfmlcgghgvitvaanaapklfadmcraalqgdialarelndrlipi
ydtmfcepspaapkwavsalgrcephvrlplvpltengqakvraalkasgql

SCOPe Domain Coordinates for d3fluc_:

Click to download the PDB-style file with coordinates for d3fluc_.
(The format of our PDB-style files is described here.)

Timeline for d3fluc_: