| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (26 species) not a true protein |
| Species Neisseria meningitidis [TaxId:491] [188931] (1 PDB entry) |
| Domain d3fluc_: 3flu C: [175897] automated match to d1dhpa_ complexed with gol, so4 |
PDB Entry: 3flu (more details), 2 Å
SCOPe Domain Sequences for d3fluc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fluc_ c.1.10.0 (C:) automated matches {Neisseria meningitidis [TaxId: 491]}
tmlqgslvalitpmnqdgsihyeqlrdlidwhiengtdgivavgttgesatlsveehtav
ieavvkhvakrvpviagtganntveaialsqaaekagadytlsvvpyynkpsqegiyqhf
ktiaeatsipmiiynvpgrtvvsmtndtilrlaeipnivgvkeasgnigsnielinrape
gfvvlsgddhtalpfmlcgghgvitvaanaapklfadmcraalqgdialarelndrlipi
ydtmfcepspaapkwavsalgrcephvrlplvpltengqakvraalkasgql
Timeline for d3fluc_: