Lineage for d3flua_ (3flu A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1343361Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1343362Protein automated matches [190115] (51 species)
    not a true protein
  7. 1343632Species Neisseria meningitidis [TaxId:491] [188931] (1 PDB entry)
  8. 1343633Domain d3flua_: 3flu A: [175895]
    automated match to d1dhpa_
    complexed with gol, so4

Details for d3flua_

PDB Entry: 3flu (more details), 2 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3flua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3flua_ c.1.10.0 (A:) automated matches {Neisseria meningitidis [TaxId: 491]}
pftmlqgslvalitpmnqdgsihyeqlrdlidwhiengtdgivavgttgesatlsveeht
avieavvkhvakrvpviagtganntveaialsqaaekagadytlsvvpyynkpsqegiyq
hfktiaeatsipmiiynvpgrtvvsmtndtilrlaeipnivgvkeasgnigsnielinra
pegfvvlsgddhtalpfmlcgghgvitvaanaapklfadmcraalqgdialarelndrli
piydtmfcepspaapkwavsalgrcephvrlplvpltengqakvraalkasgql

SCOPe Domain Coordinates for d3flua_:

Click to download the PDB-style file with coordinates for d3flua_.
(The format of our PDB-style files is described here.)

Timeline for d3flua_: