Lineage for d3flqa_ (3flq A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544248Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2544249Species Human (Homo sapiens) [TaxId:9606] [56130] (198 PDB entries)
  8. 2544277Domain d3flqa_: 3flq A: [175893]
    automated match to d1a9ua_
    complexed with 891

Details for d3flqa_

PDB Entry: 3flq (more details), 1.9 Å

PDB Description: p38 kinase crystal structure in complex with 6-(2,4-difluoro-phenoxy)- 2-((s)-2-methanesulfonyl-1-methyl-ethylamino)-8-methyl-8h-pyrido[2,3- d]pyrimidin
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d3flqa_:

Sequence, based on SEQRES records: (download)

>d3flqa_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

Sequence, based on observed residues (ATOM records): (download)

>d3flqa_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvggsvcaafdtktglrvavkklsrpfqsiihakr
tyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhv
qfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyvatrw
yrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaell
kkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahay
faqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

SCOPe Domain Coordinates for d3flqa_:

Click to download the PDB-style file with coordinates for d3flqa_.
(The format of our PDB-style files is described here.)

Timeline for d3flqa_: