Lineage for d3flla_ (3fll A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2062523Family b.60.1.1: Retinol binding protein-like [50815] (22 protein domains)
    barrel, closed; n=8, S=12, meander
  6. 2062822Protein Nitrophorin 4 [50845] (1 species)
  7. 2062823Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries)
    Uniprot Q94734 22-205
  8. 2062864Domain d3flla_: 3fll A: [175891]
    automated match to d1d2ua_
    complexed with hem, nh3; mutant

Details for d3flla_

PDB Entry: 3fll (more details), 1.5 Å

PDB Description: Crystal structure of E55Q mutant of nitrophorin 4
PDB Compounds: (A:) Nitrophorin-4

SCOPe Domain Sequences for d3flla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3flla_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkqalyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d3flla_:

Click to download the PDB-style file with coordinates for d3flla_.
(The format of our PDB-style files is described here.)

Timeline for d3flla_: