Lineage for d1glqb1 (1glq B:79-209)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48234Species Mouse (Mus musculus), class pi [TaxId:10090] [47621] (6 PDB entries)
  8. 48236Domain d1glqb1: 1glq B:79-209 [17589]
    Other proteins in same PDB: d1glqa2, d1glqb2

Details for d1glqb1

PDB Entry: 1glq (more details), 1.8 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

SCOP Domain Sequences for d1glqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glqb1 a.45.1.1 (B:79-209) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOP Domain Coordinates for d1glqb1:

Click to download the PDB-style file with coordinates for d1glqb1.
(The format of our PDB-style files is described here.)

Timeline for d1glqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glqb2