Lineage for d3flga_ (3flg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784697Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2784698Protein DNA methyltransferase DNMT3B [69251] (2 species)
  7. 2784699Species Human (Homo sapiens) [TaxId:9606] [188834] (10 PDB entries)
  8. 2784702Domain d3flga_: 3flg A: [175889]
    automated match to d1khca_

Details for d3flga_

PDB Entry: 3flg (more details), 1.8 Å

PDB Description: the pwwp domain of human dna (cytosine-5-)-methyltransferase 3 beta
PDB Compounds: (A:) DNA (cytosine-5)-methyltransferase 3B

SCOPe Domain Sequences for d3flga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3flga_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Human (Homo sapiens) [TaxId: 9606]}
eyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsad
klvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmlew
ahggfkptgieglkp

SCOPe Domain Coordinates for d3flga_:

Click to download the PDB-style file with coordinates for d3flga_.
(The format of our PDB-style files is described here.)

Timeline for d3flga_: