Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (21 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries) |
Domain d3fl9g1: 3fl9 G:1-162 [175887] Other proteins in same PDB: d3fl9a2, d3fl9c2, d3fl9d2, d3fl9e2, d3fl9f2, d3fl9g2, d3fl9h2 automated match to d1draa_ complexed with ca, top |
PDB Entry: 3fl9 (more details), 2.4 Å
SCOPe Domain Sequences for d3fl9g1:
Sequence, based on SEQRES records: (download)
>d3fl9g1 c.71.1.0 (G:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq
>d3fl9g1 c.71.1.0 (G:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha fegdtffpemdnwkevfvekgltdeknpytyyyhvyekqq
Timeline for d3fl9g1: