Lineage for d3fl9g_ (3fl9 G:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004246Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1004247Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1004553Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1004554Protein automated matches [190777] (8 species)
    not a true protein
  7. 1004555Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (10 PDB entries)
  8. 1004583Domain d3fl9g_: 3fl9 G: [175887]
    automated match to d1draa_
    complexed with ca, top

Details for d3fl9g_

PDB Entry: 3fl9 (more details), 2.4 Å

PDB Description: Crystal structure of B. anthracis dihydrofolate reductase (DHFR) with trimethoprim
PDB Compounds: (G:) dihydrofolate reductase (DHFR)

SCOPe Domain Sequences for d3fl9g_:

Sequence, based on SEQRES records: (download)

>d3fl9g_ c.71.1.0 (G:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr

Sequence, based on observed residues (ATOM records): (download)

>d3fl9g_ c.71.1.0 (G:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdnwkevfvekgltdeknpytyyyhvyekqqlvpr

SCOPe Domain Coordinates for d3fl9g_:

Click to download the PDB-style file with coordinates for d3fl9g_.
(The format of our PDB-style files is described here.)

Timeline for d3fl9g_: