Lineage for d3fl9f1 (3fl9 F:1-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904038Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)
  8. 2904098Domain d3fl9f1: 3fl9 F:1-162 [175886]
    Other proteins in same PDB: d3fl9a2, d3fl9c2, d3fl9d2, d3fl9e2, d3fl9f2, d3fl9g2, d3fl9h2
    automated match to d1draa_
    complexed with ca, top

Details for d3fl9f1

PDB Entry: 3fl9 (more details), 2.4 Å

PDB Description: Crystal structure of B. anthracis dihydrofolate reductase (DHFR) with trimethoprim
PDB Compounds: (F:) dihydrofolate reductase (DHFR)

SCOPe Domain Sequences for d3fl9f1:

Sequence, based on SEQRES records: (download)

>d3fl9f1 c.71.1.0 (F:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Sequence, based on observed residues (ATOM records): (download)

>d3fl9f1 c.71.1.0 (F:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d3fl9f1:

Click to download the PDB-style file with coordinates for d3fl9f1.
(The format of our PDB-style files is described here.)

Timeline for d3fl9f1: