SCOPe 2.05: Domain d3fl8h_: 3fl8 H:

Lineage for d3fl8h_ (3fl8 H:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d3fl8h_: 3fl8 H: [175880]
   automated match to d1draa_
   complexed with ca, rar

Details for d3fl8h_

PDB Entry: 3fl8, 2.29 Å

PDB Description: Crystal structure of B. anthracis dihydrofolate reductase (DHFR) with RAB1, a TMP-dihydrophthalazine derivative

PDB Compounds: (H:) dihydrofolate reductase

SCOPe Domain Sequences for d3fl8h_:

Sequence, based on SEQRES records:

>d3fl8h_ c.71.1.0 (H:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr

Sequence, based on observed residues (ATOM records):

>d3fl8h_ c.71.1.0 (H:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrncevahsveevfelceeeififggaqiydlflpyvdklyitkihhafegdtffpe
mdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr

Timeline for d3fl8h_:

• d3fl8h_ first appeared in SCOPe 2.01
  
• d3fl8h_ appears in SCOPe 2.04
  
• d3fl8h_ is called d3fl8h1 in SCOPe 2.06
  
• d3fl8h_ appears in the current release, SCOPe 2.08, called d3fl8h1