Lineage for d3fl8g1 (3fl8 G:1-162)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2154171Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2154172Protein automated matches [190777] (21 species)
    not a true protein
  7. 2154177Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)
  8. 2154204Domain d3fl8g1: 3fl8 G:1-162 [175879]
    Other proteins in same PDB: d3fl8a2, d3fl8b2, d3fl8c2, d3fl8d2, d3fl8e2, d3fl8f2, d3fl8g2, d3fl8h2
    automated match to d1draa_
    complexed with ca, rar

Details for d3fl8g1

PDB Entry: 3fl8 (more details), 2.29 Å

PDB Description: Crystal structure of B. anthracis dihydrofolate reductase (DHFR) with RAB1, a TMP-dihydrophthalazine derivative
PDB Compounds: (G:) dihydrofolate reductase

SCOPe Domain Sequences for d3fl8g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fl8g1 c.71.1.0 (G:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d3fl8g1:

Click to download the PDB-style file with coordinates for d3fl8g1.
(The format of our PDB-style files is described here.)

Timeline for d3fl8g1: