![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (27 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries) |
![]() | Domain d3fl8f1: 3fl8 F:1-162 [175878] Other proteins in same PDB: d3fl8a2, d3fl8b2, d3fl8c2, d3fl8d2, d3fl8e2, d3fl8f2, d3fl8g2, d3fl8h2 automated match to d1draa_ complexed with ca, rar |
PDB Entry: 3fl8 (more details), 2.29 Å
SCOPe Domain Sequences for d3fl8f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fl8f1 c.71.1.0 (F:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq
Timeline for d3fl8f1: