SCOPe 2.05: Domain d3fl1b_: 3fl1 B:

Lineage for d3fl1b_ (3fl1 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (177 PDB entries)

8. Domain d3fl1b_: 3fl1 B: [175868]
   automated match to d1a2wa_
   complexed with cgp, so4, tre; mutant

Details for d3fl1b_

PDB Entry: 3fl1, 1.9 Å

PDB Description: x-ray structure of the non covalent swapped form of the a19p/q28l/k31c/s32c mutant of bovine pancreatic ribonuclease in complex with 2'-deoxycytidine-2'-deoxyguanosine-3',5'-monophosphate

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3fl1b_:

Sequence; same for both SEQRES and ATOM records:

>d3fl1b_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstspasssnycnlmmccrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d3fl1b_:

• d3fl1b_ first appeared in SCOPe 2.01
  
• d3fl1b_ appears in SCOPe 2.04
  
• d3fl1b_ appears in SCOPe 2.06
  
• d3fl1b_ appears in the current release, SCOPe 2.08