Lineage for d3fkzb_ (3fkz B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928145Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. 2928150Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)
  8. 2928300Domain d3fkzb_: 3fkz B: [175864]
    automated match to d1kf2a_
    mutant

Details for d3fkzb_

PDB Entry: 3fkz (more details), 1.99 Å

PDB Description: x-ray structure of the non covalent swapped form of the s16g/t17n/a19p/a20s/k31c/s32c mutant of bovine pancreatic ribonuclease
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3fkzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fkzb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsgnspssssnycnqmmccrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d3fkzb_:

Click to download the PDB-style file with coordinates for d3fkzb_.
(The format of our PDB-style files is described here.)

Timeline for d3fkzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fkza_