Lineage for d3fkbe_ (3fkb E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951533Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [186756] (3 PDB entries)
  8. 2951539Domain d3fkbe_: 3fkb E: [175853]
    automated match to d1b4sa_
    complexed with edo, gol, mg, tnm, tnv

Details for d3fkbe_

PDB Entry: 3fkb (more details), 1.65 Å

PDB Description: structure of ndpk h122g and tenofovir-diphosphate
PDB Compounds: (E:) Nucleoside diphosphate kinase, cytosolic

SCOPe Domain Sequences for d3fkbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fkbe_ d.58.6.1 (E:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
nkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpffg
glvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsds
vesanreialwfkpeelltevkpnpnlye

SCOPe Domain Coordinates for d3fkbe_:

Click to download the PDB-style file with coordinates for d3fkbe_.
(The format of our PDB-style files is described here.)

Timeline for d3fkbe_: