SCOPe 2.06: Domain d3fjua_: 3fju A:

Lineage for d3fjua_ (3fju A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein automated matches [190397] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188484] (5 PDB entries)

8. Domain d3fjua_: 3fju A: [175844]
   automated match to d1arla_
   complexed with act, cac, na, zn

Details for d3fjua_

PDB Entry: 3fju, 1.6 Å

PDB Description: ascaris suum carboxypeptidase inhibitor in complex with human carboxypeptidase a1

PDB Compounds: (A:) Carboxypeptidase A1

SCOPe Domain Sequences for d3fjua_:

Sequence; same for both SEQRES and ATOM records:

>d3fjua_ c.56.5.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrpa
iwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafths
tnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksivd
fvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfnyg
siikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlalltim
ehtlnhp

Timeline for d3fjua_:

• d3fjua_ first appeared in SCOPe 2.01
  
• d3fjua_ appears in SCOPe 2.05
  
• d3fjua_ appears in SCOPe 2.07
  
• d3fjua_ appears in the current release, SCOPe 2.08