![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins) Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals |
![]() | Protein automated matches [191017] (1 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [188787] (1 PDB entry) |
![]() | Domain d3fifh_: 3fif H: [175830] automated match to d2jn0a1 |
PDB Entry: 3fif (more details), 2.7 Å
SCOPe Domain Sequences for d3fifh_:
Sequence, based on SEQRES records: (download)
>d3fifh_ b.38.1.6 (H:) automated matches {Escherichia coli K-12 [TaxId: 83333]} ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehh
>d3fifh_ b.38.1.6 (H:) automated matches {Escherichia coli K-12 [TaxId: 83333]} ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgamqinrddvsqiierlehh
Timeline for d3fifh_: