Lineage for d3fife_ (3fif E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123076Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1123077Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1123474Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 1123507Protein automated matches [191017] (1 species)
    not a true protein
  7. 1123508Species Escherichia coli K-12 [TaxId:83333] [188787] (1 PDB entry)
  8. 1123513Domain d3fife_: 3fif E: [175827]
    automated match to d2jn0a1

Details for d3fife_

PDB Entry: 3fif (more details), 2.7 Å

PDB Description: Crystal structure of the ygdR protein from E.coli. Northeast Structural Genomics target ER382A.
PDB Compounds: (E:) Uncharacterized lipoprotein ygdR

SCOPe Domain Sequences for d3fife_:

Sequence, based on SEQRES records: (download)

>d3fife_ b.38.1.6 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehh

Sequence, based on observed residues (ATOM records): (download)

>d3fife_ b.38.1.6 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ssdyvmatkdgrmiltdgkpeidddtglvsyhdamqinrddvsqiierlehh

SCOPe Domain Coordinates for d3fife_:

Click to download the PDB-style file with coordinates for d3fife_.
(The format of our PDB-style files is described here.)

Timeline for d3fife_: