![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
![]() | Superfamily d.24.1: Pili subunits [54523] (8 families) ![]() bacterial filament proteins |
![]() | Family d.24.1.1: Pilin [54524] (5 proteins) |
![]() | Protein automated matches [190127] (3 species) not a true protein |
![]() | Species Salmonella typhi [TaxId:601] [189084] (2 PDB entries) |
![]() | Domain d3fhvb_: 3fhv B: [175793] automated match to d1q5fa_ |
PDB Entry: 3fhv (more details), 1.9 Å
SCOPe Domain Sequences for d3fhvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fhvb_ d.24.1.1 (B:) automated matches {Salmonella typhi [TaxId: 601]} agteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpasgsatlw nswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikingnnhtd akvtaeiassectadngrtgtntlvfnyng
Timeline for d3fhvb_: