Lineage for d3fhub_ (3fhu B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1022488Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1022489Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 1022490Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 1022511Protein automated matches [190127] (3 species)
    not a true protein
  7. 1022521Species Salmonella typhi [TaxId:601] [189084] (2 PDB entries)
  8. 1022525Domain d3fhub_: 3fhu B: [175791]
    automated match to d1q5fa_

Details for d3fhub_

PDB Entry: 3fhu (more details), 2.1 Å

PDB Description: crystal structure of type iv b pilin from salmonella typhi
PDB Compounds: (B:) Prepilin

SCOPe Domain Sequences for d3fhub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhub_ d.24.1.1 (B:) automated matches {Salmonella typhi [TaxId: 601]}
agteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpasgsatlw
nswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikingnnhtd
akvtaeiassectadngrtgtntlvfnyng

SCOPe Domain Coordinates for d3fhub_:

Click to download the PDB-style file with coordinates for d3fhub_.
(The format of our PDB-style files is described here.)

Timeline for d3fhub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fhua_