Lineage for d3fhua_ (3fhu A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509472Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2509473Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2509474Family d.24.1.1: Pilin [54524] (5 protein domains)
  6. 2509495Protein automated matches [190127] (3 species)
    not a true protein
  7. 2509505Species Salmonella typhi [TaxId:601] [189084] (2 PDB entries)
  8. 2509508Domain d3fhua_: 3fhu A: [175790]
    automated match to d1q5fa_

Details for d3fhua_

PDB Entry: 3fhu (more details), 2.1 Å

PDB Description: crystal strcuture of type iv b pilin from salmonella typhi
PDB Compounds: (A:) Prepilin

SCOPe Domain Sequences for d3fhua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhua_ d.24.1.1 (A:) automated matches {Salmonella typhi [TaxId: 601]}
agteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpasgsatlw
nswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikingnnhtd
akvtaeiassectadngrtgtntlvfnyng

SCOPe Domain Coordinates for d3fhua_:

Click to download the PDB-style file with coordinates for d3fhua_.
(The format of our PDB-style files is described here.)

Timeline for d3fhua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fhub_