Lineage for d3fhjc_ (3fhj C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105469Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2105470Species Bacillus stearothermophilus [TaxId:1422] [52379] (12 PDB entries)
  8. 2105498Domain d3fhjc_: 3fhj C: [175786]
    automated match to d1m83a_
    complexed with amp, po4, trp

Details for d3fhjc_

PDB Entry: 3fhj (more details), 2.65 Å

PDB Description: independent saturation of three trprs subsites generates a partially- assembled state similar to those observed in molecular simulations
PDB Compounds: (C:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3fhjc_:

Sequence, based on SEQRES records: (download)

>d3fhjc_ c.26.1.1 (C:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

Sequence, based on observed residues (ATOM records): (download)

>d3fhjc_ c.26.1.1 (C:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqtignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirrlaaly
lavgidptqatlfiqsevpahaqaawmlqcivyigelermtqvsaglltypplmaadill
yntdivpvgedqkqhieltrdlaerfnkryftipearipkvgarimslvdptkkmsksdp
npkayitllddaktiekkikssegtpgisnllniystlgvfkadlaqvvietlrpiqery
hhwmeseeldrvldegaekanrvasemvrkmeqamglgr

SCOPe Domain Coordinates for d3fhjc_:

Click to download the PDB-style file with coordinates for d3fhjc_.
(The format of our PDB-style files is described here.)

Timeline for d3fhjc_: